PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN35392.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 281aa    MW: 31874.9 Da    PI: 7.8577
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN35392.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed ll ++++ +G g+W++ +++ g+ R++k+c++rw +yl
       KHN35392.1 14 RGPWTPREDALLTKYIQTHGEGQWRSLPKRAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding54.72.4e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eEd+l+v+ + +lG++ W++Ia +++ gRt++++k++w+++l
       KHN35392.1  67 RGNITPEEDDLIVRMHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112
                      7999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.699961IPR017930Myb domain
SuperFamilySSF466893.56E-3011108IPR009057Homeodomain-like
SMARTSM007173.9E-131363IPR001005SANT/Myb domain
PfamPF002495.8E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-241568IPR009057Homeodomain-like
CDDcd001673.06E-101661No hitNo description
PROSITE profilePS5129427.19362116IPR017930Myb domain
SMARTSM007171.3E-1666114IPR001005SANT/Myb domain
PfamPF002492.1E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-2769116IPR009057Homeodomain-like
CDDcd001673.30E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGRAPCCSKV GLHRGPWTPR EDALLTKYIQ THGEGQWRSL PKRAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI TPEEDDLIVR MHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HLSKKLRNQG  120
TDPKTHDKLT EAPEKKKGKK KNKQKNENNK GSEKTLVYLP KPIRVKALSS CIPRTDSTLT  180
LNSNSATAST SEEKVQSPEA EVKEVNMVWG VGDDADNGGI EIFFGEDHDL VNNTASYEEC  240
YSDVHTDDHG TLEKLYEEYL QLLNVEEKPD ELDSFAQSLL V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235820.10.0MYB transcription factor MYB185
TrEMBLA0A0B2RUA60.0A0A0B2RUA6_GLYSO; Transcription repressor MYB5
TrEMBLQ0PJK20.0Q0PJK2_SOYBN; MYB transcription factor MYB185
STRINGGLYMA19G44660.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.13e-68myb domain protein 5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]